SCOPe 2.08: Domain d7cjif_: 7cji f:

Lineage for d7cjif_ (7cji f:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)

8. Domain d7cjif_: 7cji f: [403315]
   Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
   automated match to d3a0hf_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjif_

PDB Entry: 7cji, 2.35 Å

PDB Description: photosystem ii structure in the s1 state

PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7cjif_:

Sequence; same for both SEQRES and ATOM records:

>d7cjif_ f.23.38.1 (f:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
iftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d7cjif_:

• d7cjif_ first appeared in SCOPe 2.07