SCOPe 2.08: Domain d7cjio_: 7cji o:

Lineage for d7cjio_ (7cji o:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.4: PsbO-like [161115] (2 proteins)
   Pfam PF01716; MSP

6. Protein Manganese-stabilising protein, PsbO [161116] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries)

8. Domain d7cjio_: 7cji o: [403271]
   Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
   automated match to d4il6o_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjio_

PDB Entry: 7cji, 2.35 Å

PDB Description: photosystem ii structure in the s1 state

PDB Compounds: (o:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d7cjio_:

Sequence; same for both SEQRES and ATOM records:

>d7cjio_ f.4.1.4 (o:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

Timeline for d7cjio_:

• d7cjio_ first appeared in SCOPe 2.07