![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries) |
![]() | Domain d7coua_: 7cou A: [403164] Other proteins in same PDB: d7coub_, d7couc_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_ automated match to d2axta1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cou (more details), 2.25 Å
SCOPe Domain Sequences for d7coua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7coua_ f.26.1.1 (A:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva ahgyfgrlifqyasfnnsrslhfflaawpvvgvwfaalgistmafnlngfnfnhsvidak gnvintwadiinranlgmevmhernahnfpldla
Timeline for d7coua_: