Lineage for d7couo_ (7cou O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021998Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 3021999Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 3022002Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries)
  8. 3022016Domain d7couo_: 7cou O: [403128]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d4il6o_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7couo_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d7couo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7couo_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d7couo_:

Click to download the PDB-style file with coordinates for d7couo_.
(The format of our PDB-style files is described here.)

Timeline for d7couo_: