Lineage for d7couj_ (7cou j:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026451Protein automated matches [191002] (3 species)
    not a true protein
  7. 3026459Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)
  8. 3026470Domain d7couj_: 7cou j: [403137]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d5ws5j_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7couj_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d7couj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7couj_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mseggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d7couj_:

Click to download the PDB-style file with coordinates for d7couj_.
(The format of our PDB-style files is described here.)

Timeline for d7couj_: