Lineage for d7couh_ (7cou H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026491Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 3026501Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)
  8. 3026508Domain d7couh_: 7cou H: [403171]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d5v2ch_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7couh_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7couh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7couh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

SCOPe Domain Coordinates for d7couh_:

Click to download the PDB-style file with coordinates for d7couh_.
(The format of our PDB-style files is described here.)

Timeline for d7couh_: