![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
![]() | Domain d7couh_: 7cou H: [403171] Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_ automated match to d5v2ch_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cou (more details), 2.25 Å
SCOPe Domain Sequences for d7couh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7couh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkal
Timeline for d7couh_: