Lineage for d7coue_ (7cou e:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026746Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 3026755Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)
  8. 3026767Domain d7coue_: 7cou e: [403305]
    Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

    has additional insertions and/or extensions that are not grouped together

Details for d7coue_

PDB Entry: 7cou (more details), 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state
PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d7coue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7coue_ f.23.38.1 (e:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
gerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsipl
vtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d7coue_:

Click to download the PDB-style file with coordinates for d7coue_.
(The format of our PDB-style files is described here.)

Timeline for d7coue_: