![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
![]() | Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
![]() | Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries) |
![]() | Domain d7cout_: 7cou t: [403180] Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7couu_, d7couv_, d7coux_, d7couz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cou (more details), 2.25 Å
SCOPe Domain Sequences for d7cout_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cout_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
Timeline for d7cout_: