| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries) |
| Domain d7cjjf_: 7cjj F: [403139] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d3a0hf_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjjf_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d7cjjf_: