Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
Domain d7cjju_: 7cjj U: [403108] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjju_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjju_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt erqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d7cjju_: