Lineage for d7cjjv_ (7cjj v:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304309Protein Cytochrome c550 [100991] (3 species)
  7. 2304315Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)
  8. 2304328Domain d7cjjv_: 7cjj v: [403105]
    Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjx_, d7cjjz_
    automated match to d3a0hv_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjv_

PDB Entry: 7cjj (more details), 2.4 Å

PDB Description: photosystem ii structure in the s2 state
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d7cjjv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjjv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d7cjjv_:

Click to download the PDB-style file with coordinates for d7cjjv_.
(The format of our PDB-style files is described here.)

Timeline for d7cjjv_: