| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
| Domain d7cjjm_: 7cjj M: [403106] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjjm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjjm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqq
Timeline for d7cjjm_: