Lineage for d7cjjm_ (7cjj M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631925Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2631938Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)
  8. 2631954Domain d7cjjm_: 7cjj M: [403106]
    Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjm_

PDB Entry: 7cjj (more details), 2.4 Å

PDB Description: photosystem ii structure in the s2 state
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7cjjm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjjm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqq

SCOPe Domain Coordinates for d7cjjm_:

Click to download the PDB-style file with coordinates for d7cjjm_.
(The format of our PDB-style files is described here.)

Timeline for d7cjjm_: