Lineage for d7cjjl_ (7cjj l:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631727Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2631728Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2631729Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2631737Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)
  8. 2631759Domain d7cjjl_: 7cjj l: [403156]
    Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_
    automated match to d3a0hl_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjl_

PDB Entry: 7cjj (more details), 2.4 Å

PDB Description: photosystem ii structure in the s2 state
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7cjjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjjl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d7cjjl_:

Click to download the PDB-style file with coordinates for d7cjjl_.
(The format of our PDB-style files is described here.)

Timeline for d7cjjl_: