Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
Domain d7cjjh_: 7cjj h: [403094] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d5v2ch_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjjh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjjh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkal
Timeline for d7cjjh_: