Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries) |
Domain d7cjji_: 7cjj I: [403142] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d2axti1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjji_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjji_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]} metlkitvyivvtffvllfvfgflsgdparnpkrkdle
Timeline for d7cjji_: