![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries) |
![]() | Domain d7cjjk_: 7cjj k: [403097] Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cjj (more details), 2.4 Å
SCOPe Domain Sequences for d7cjjk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjjk_ f.23.36.1 (k:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d7cjjk_: