Lineage for d6ymxp2 (6ymx P:87-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782421Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257477] (2 PDB entries)
  8. 2782423Domain d6ymxp2: 6ymx P:87-215 [393691]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d3cx5e1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxp2

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6ymxp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxp2 b.33.1.1 (P:87-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOPe Domain Coordinates for d6ymxp2:

Click to download the PDB-style file with coordinates for d6ymxp2.
(The format of our PDB-style files is described here.)

Timeline for d6ymxp2:

2782423
d6ymxp2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6ymxp1