SCOPe 2.08: Domain d6ymxf_: 6ymx F:

Lineage for d6ymxf_ (6ymx F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (7 PDB entries)

8. Domain d6ymxf_: 6ymx F: [393704]
   Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxr_, d6ymxs_, d6ymxt_
   automated match to d1kb9f_
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxf_

PDB Entry: 6ymx, 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae

PDB Compounds: (F:) cytochrome b-c1 complex subunit 6, mitochondrial

SCOPe Domain Sequences for d6ymxf_:

Sequence; same for both SEQRES and ATOM records:

>d6ymxf_ f.28.1.1 (F:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

Timeline for d6ymxf_:

• d6ymxf_ first appeared in SCOPe 2.07