Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257467] (3 PDB entries) |
Domain d6ymxn1: 6ymx N:1-261 [393696] Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_ automated match to d1kb9c2 complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn |
PDB Entry: 6ymx (more details), 3.17 Å
SCOPe Domain Sequences for d6ymxn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ymxn1 f.21.1.2 (N:1-261) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil alfvfyspntlghpdnyipgn
Timeline for d6ymxn1:
View in 3D Domains from other chains: (mouse over for more information) d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_ |