Lineage for d6ymxn1 (6ymx N:1-261)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024589Protein automated matches [196844] (6 species)
    not a true protein
  7. 3024590Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257467] (3 PDB entries)
  8. 3024591Domain d6ymxn1: 6ymx N:1-261 [393696]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d1kb9c2
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxn1

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (N:) cytochrome b

SCOPe Domain Sequences for d6ymxn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxn1 f.21.1.2 (N:1-261) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

SCOPe Domain Coordinates for d6ymxn1:

Click to download the PDB-style file with coordinates for d6ymxn1.
(The format of our PDB-style files is described here.)

Timeline for d6ymxn1:

3024591
d6ymxn1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6ymxn2