Lineage for d6ymxp1 (6ymx P:31-86)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025862Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 3025917Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 3025918Protein automated matches [254432] (4 species)
    not a true protein
  7. 3025919Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257475] (2 PDB entries)
  8. 3025921Domain d6ymxp1: 6ymx P:31-86 [393690]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d3cx5e2
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxp1

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6ymxp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxp1 f.23.12.0 (P:31-86) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d6ymxp1:

Click to download the PDB-style file with coordinates for d6ymxp1.
(The format of our PDB-style files is described here.)

Timeline for d6ymxp1: