SCOPe 2.08: Domain d6ymxc_: 6ymx c:

Lineage for d6ymxc_ (6ymx c:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.0: automated matches [393699] (1 protein)
   not a true family

6. Protein automated matches [393700] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [393701] (1 PDB entry)

8. Domain d6ymxc_: 6ymx c: [393702]
   Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
   automated match to d3ag3c_
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxc_

PDB Entry: 6ymx, 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae

PDB Compounds: (c:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6ymxc_:

Sequence; same for both SEQRES and ATOM records:

>d6ymxc_ f.25.1.0 (c:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
thlersrhqqhpfhmvmpspwpivvsfallslalstaltmhgyignmnmvylalfvllts
silwfrdivaeatylgdhtmavrkginlgflmfvlsevlifaglfwayfhsamspdvtlg
acwppvgieavqptelpllntiillssgatvtyshhaliagnrnkalsgllitfwlivif
vtcqyieytnaaftisdgvygsvfyagtglhflhmvmlaamlgvnywrmrnyhltaghhv
gyettiiythvldviwlflyvvfywwgv

Timeline for d6ymxc_:

• d6ymxc_ first appeared in SCOPe 2.07