Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.0: automated matches [393699] (1 protein) not a true family |
Protein automated matches [393700] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [393701] (1 PDB entry) |
Domain d6ymxc_: 6ymx c: [393702] Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_ automated match to d3ag3c_ complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn |
PDB Entry: 6ymx (more details), 3.17 Å
SCOPe Domain Sequences for d6ymxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ymxc_ f.25.1.0 (c:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} thlersrhqqhpfhmvmpspwpivvsfallslalstaltmhgyignmnmvylalfvllts silwfrdivaeatylgdhtmavrkginlgflmfvlsevlifaglfwayfhsamspdvtlg acwppvgieavqptelpllntiillssgatvtyshhaliagnrnkalsgllitfwlivif vtcqyieytnaaftisdgvygsvfyagtglhflhmvmlaamlgvnywrmrnyhltaghhv gyettiiythvldviwlflyvvfywwgv
Timeline for d6ymxc_:
View in 3D Domains from other chains: (mouse over for more information) d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_ |