PDB entry 6ymx

View 6ymx on RCSB PDB site
Description: CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae
Class: electron transport
Keywords: Complex, CIII, CIV, Supercomplex, ELECTRON TRANSPORT
Deposited on 2020-04-10, released 2020-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: EM
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxa1, d6ymxa2
  • Chain 'B':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxb1, d6ymxb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxd1, d6ymxd2
  • Chain 'E':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxe1, d6ymxe2
  • Chain 'F':
    Compound: cytochrome b-c1 complex subunit 6, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxf_
  • Chain 'G':
    Compound: Cytochrome b-c1 complex subunit 7, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxg_
  • Chain 'H':
    Compound: Cytochrome b-c1 complex subunit 8, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxh_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxi_
  • Chain 'L':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxl1, d6ymxl2
  • Chain 'M':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxm1, d6ymxm2
  • Chain 'N':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxn1, d6ymxn2
  • Chain 'O':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxo1, d6ymxo2
  • Chain 'P':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxp1, d6ymxp2
  • Chain 'Q':
    Compound: cytochrome b-c1 complex subunit 6, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxq_
  • Chain 'R':
    Compound: Cytochrome b-c1 complex subunit 7, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxr_
  • Chain 'S':
    Compound: Cytochrome b-c1 complex subunit 8, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxs_
  • Chain 'T':
    Compound: Cytochrome b-c1 complex subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxt_
  • Chain 'U':
    Compound: Cytochrome b-c1 complex subunit 10, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Cytochrome b-c1 complex subunit 10, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Cytochrome c oxidase subunit 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Cytochrome c oxidase subunit 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Cytochrome c oxidase subunit 3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxc_
  • Chain 'd':
    Compound: Cytochrome c oxidase subunit 4, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: cytochrome c oxidase subunit 5a, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Cytochrome c oxidase subunit 6, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Cytochrome c oxidase subunit 7, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Cytochrome c oxidase subunit 8, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Cytochrome c oxidase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Cytochrome c oxidase subunit 12, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ymxj_
  • Chain 'k':
    Compound: Cytochrome c oxidase subunit 13, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Cytochrome c oxidase subunit 26, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEA, HEM, PCF, PTY, CU, CN3, CUA, ZN, 6PH, 8PE, CN5, UQ6, 9PE, 7PH, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxA (A:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfeendhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxB (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxE (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxF (F:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxG (G:)
    pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
    rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
    nievsk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxH (H:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxI (I:)
    slyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxL (L:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfeendhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxM (M:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxN (N:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxO (O:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxP (P:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxQ (Q:)
    evtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqh
    yldtataprlfdklk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxR (R:)
    pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
    rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
    nievsk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxS (S:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxT (T:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkaria
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxc (c:)
    thlersrhqqhpfhmvmpspwpivvsfallslalstaltmhgyignmnmvylalfvllts
    silwfrdivaeatylgdhtmavrkginlgflmfvlsevlifaglfwayfhsamspdvtlg
    acwppvgieavqptelpllntiillssgatvtyshhaliagnrnkalsgllitfwlivif
    vtcqyieytnaaftisdgvygsvfyagtglhflhmvmlaamlgvnywrmrnyhltaghhv
    gyettiiythvldviwlflyvvfywwgv
    

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ymxj (j:)
    nsplhtvgfdarfpqqnqtkhcwqsyvdyhkcvnmkgedfapckvfwktynalcpldwie
    kwddqrekgifagdinsd
    

  • Chain 'k':
    No sequence available.

  • Chain 'm':
    No sequence available.