| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein automated matches [196649] (5 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [375266] (1 PDB entry) |
| Domain d5zznm_: 5zzn m: [375267] Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant |
PDB Entry: 5zzn (more details), 2.1 Å
SCOPe Domain Sequences for d5zznm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zznm_ f.23.35.1 (m:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d5zznm_: