Lineage for d5zznm_ (5zzn m:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631960Protein automated matches [196649] (5 species)
    not a true protein
  7. 2631967Species Thermosynechococcus elongatus [TaxId:197221] [375266] (1 PDB entry)
  8. 2631968Domain d5zznm_: 5zzn m: [375267]
    Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznm_

PDB Entry: 5zzn (more details), 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus
PDB Compounds: (m:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5zznm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zznm_ f.23.35.1 (m:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d5zznm_:

Click to download the PDB-style file with coordinates for d5zznm_.
(The format of our PDB-style files is described here.)

Timeline for d5zznm_: