| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
| Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [158541] (3 PDB entries) Uniprot Q9F1L5 37-134 |
| Domain d5zznu_: 5zzn u: [375250] Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznv_, d5zznx_, d5zznz_ automated match to d5h2fu_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant |
PDB Entry: 5zzn (more details), 2.1 Å
SCOPe Domain Sequences for d5zznu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zznu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d5zznu_: