SCOPe 2.08: Domain d5zznz_: 5zzn Z:

Lineage for d5zznz_ (5zzn Z:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.5: PsbZ-like [161055] (2 families)
   automatically mapped to Pfam PF01737

5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
   Pfam PF01737; Ycf9

6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161058] (9 PDB entries)
   Uniprot Q8DHJ2 1-62

8. Domain d5zznz_: 5zzn Z: [375271]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_
   automated match to d5h2fz_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznz_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5zznz_:

Sequence; same for both SEQRES and ATOM records:

>d5zznz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

Timeline for d5zznz_:

• d5zznz_ first appeared in SCOPe 2.07