SCOPe 2.08: Domain d5zznv_: 5zzn v:

Lineage for d5zznv_ (5zzn v:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c550 [100991] (3 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [338583] (2 PDB entries)

8. Domain d5zznv_: 5zzn v: [375253]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznx_, d5zznz_
   automated match to d5h2fv_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznv_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d5zznv_:

Sequence; same for both SEQRES and ATOM records:

>d5zznv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

Timeline for d5zznv_:

• d5zznv_ first appeared in SCOPe 2.07