| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
| Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
| Protein automated matches [375246] (1 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [375247] (1 PDB entry) |
| Domain d5zznt_: 5zzn T: [375248] Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznu_, d5zznv_, d5zznx_, d5zznz_ automated match to d3bz2t_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant |
PDB Entry: 5zzn (more details), 2.1 Å
SCOPe Domain Sequences for d5zznt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zznt_ f.23.34.1 (T:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
metityvfifaciialfffaiffrepprit
Timeline for d5zznt_: