Lineage for d5zznc_ (5zzn C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028901Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)
  8. 3028917Domain d5zznc_: 5zzn C: [375244]
    Other proteins in same PDB: d5zzna_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
    automated match to d5b66c_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznc_

PDB Entry: 5zzn (more details), 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus
PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5zznc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zznc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d5zznc_:

Click to download the PDB-style file with coordinates for d5zznc_.
(The format of our PDB-style files is described here.)

Timeline for d5zznc_: