Lineage for d6jy3h_ (6jy3 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323609Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2323610Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2323611Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2323612Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2323613Species Cow (Bos taurus) [TaxId:9913] [47697] (27 PDB entries)
  8. 3074141Domain d6jy3h_: 6jy3 H: [374203]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
    automated match to d1v54h_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3h_

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d6jy3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d6jy3h_:

Click to download the PDB-style file with coordinates for d6jy3h_.
(The format of our PDB-style files is described here.)

Timeline for d6jy3h_: