PDB entry 6jy3

View 6jy3 on RCSB PDB site
Description: Monomeric Form of Bovine Heart Cytochrome c Oxidase in the Fully Oxidized State
Class: oxidoreductase
Keywords: Monomer, Fully Oxidized, OXIDOREDUCTASE
Deposited on 2019-04-26, released 2019-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3b1, d6jy3b2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3c_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3d_
  • Chain 'E':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3e_
  • Chain 'F':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3f_
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 6A2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3g_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3h_
  • Chain 'I':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3i_
  • Chain 'J':
    Compound: Cytochrome c oxidase subunit 7A1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3j_
  • Chain 'K':
    Compound: Cytochrome c oxidase subunit 7B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3k_
  • Chain 'L':
    Compound: cytochrome c oxidase subunit 7c, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3l_
  • Chain 'M':
    Compound: Cytochrome c oxidase subunit 8B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jy3m_
  • Heterogens: CDL, CHD, CQX, HEA, CU, MG, NA, PER, PGV, CUA, PEK, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jy3A (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jy3B (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jy3C (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3C (C:)
    qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
    estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
    lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
    apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
    fvdvvwlflyvsiy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jy3D (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3D (D:)
    yalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlkfkesfae
    mnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrmldmkvap
    iqgfsakwdydknewk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6jy3E (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3E (E:)
    tdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasavr
    ilevvkdkagphkeiypyviqelrptlnelgistpeelgldk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6jy3F (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3F (F:)
    gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic
    eednstviwfwlhkgeaqrcpscgthyklvp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6jy3G (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3G (G:)
    gartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpfswgdgnhtffh
    nprvnplptgye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6jy3H (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3H (H:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6jy3I (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3I (I:)
    alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
    mrkagifqsa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6jy3J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6jy3K (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3K (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6jy3L (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3L (L:)
    yeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6jy3M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy3M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldny