Lineage for d6jy3k_ (6jy3 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025247Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 3025248Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 3025249Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025250Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries)
  8. 3025277Domain d6jy3k_: 6jy3 K: [374164]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3l_, d6jy3m_
    automated match to d1v54k_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3k_

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (K:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d6jy3k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d6jy3k_:

Click to download the PDB-style file with coordinates for d6jy3k_.
(The format of our PDB-style files is described here.)

Timeline for d6jy3k_: