SCOPe 2.08: Domain d6jy3i_: 6jy3 I:

Lineage for d6jy3i_ (6jy3 I:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)

8. Domain d6jy3i_: 6jy3 I: [374204]
   Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
   automated match to d1v54i_
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3i_

PDB Entry: 6jy3, 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d6jy3i_:

Sequence; same for both SEQRES and ATOM records:

>d6jy3i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
mrkagifqsa

Timeline for d6jy3i_:

• d6jy3i_ first appeared in SCOPe 2.07