Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) automatically mapped to Pfam PF02238 |
Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries) |
Domain d6jy3j_: 6jy3 J: [374186] Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3k_, d6jy3l_, d6jy3m_ automated match to d1v54j_ complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn |
PDB Entry: 6jy3 (more details), 1.85 Å
SCOPe Domain Sequences for d6jy3j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy3j_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]} fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasf
Timeline for d6jy3j_: