Lineage for d6jy3c_ (6jy3 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (56 PDB entries)
  8. 3027224Domain d6jy3c_: 6jy3 C: [374168]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
    automated match to d1v54c_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3c_

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6jy3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
fvdvvwlflyvsiy

SCOPe Domain Coordinates for d6jy3c_:

Click to download the PDB-style file with coordinates for d6jy3c_.
(The format of our PDB-style files is described here.)

Timeline for d6jy3c_: