Lineage for d6jy3b2 (6jy3 B:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771100Domain d6jy3b2: 6jy3 B:91-227 [374199]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
    automated match to d1v54b1
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3b2

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6jy3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3b2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d6jy3b2:

Click to download the PDB-style file with coordinates for d6jy3b2.
(The format of our PDB-style files is described here.)

Timeline for d6jy3b2: