Lineage for d6n8de2 (6n8d E:107-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (950 PDB entries)
  8. 3070669Domain d6n8de2: 6n8d E:107-211 [370731]
    Other proteins in same PDB: d6n8db1, d6n8de1
    automated match to d1dn0a2

Details for d6n8de2

PDB Entry: 6n8d (more details), 3.1 Å

PDB Description: crystal structure of gii.4 2002 norovirus p domain in complex with neutralizing human antibody a1431
PDB Compounds: (E:) A1431 Fab light chain

SCOPe Domain Sequences for d6n8de2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n8de2 b.1.1.2 (E:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6n8de2:

Click to download the PDB-style file with coordinates for d6n8de2.
(The format of our PDB-style files is described here.)

Timeline for d6n8de2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6n8de1