Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6n8db2: 6n8d B:107-211 [370738] Other proteins in same PDB: d6n8da_, d6n8db1, d6n8dc_, d6n8dd_, d6n8de1, d6n8df_ automated match to d1dn0a2 |
PDB Entry: 6n8d (more details), 3.1 Å
SCOPe Domain Sequences for d6n8db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n8db2 b.1.1.2 (B:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d6n8db2: