PDB entry 6n8d

View 6n8d on RCSB PDB site
Description: Crystal structure of GII.4 2002 norovirus P domain in complex with neutralizing human antibody A1431
Class: immune system
Keywords: Norovirus, human antibody, Fab, complex, neutralizing, IMMUNE SYSTEM
Deposited on 2018-11-29, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein
    Species: Norovirus Hu/GII.4/Farmington Hills/2004/USA [TaxId:1182143]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: A1431 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6N8D (0-End)
    Domains in SCOPe 2.07: d6n8db1, d6n8db2
  • Chain 'C':
    Compound: Major capsid protein
    Species: Norovirus Hu/GII.4/Farmington Hills/2004/USA [TaxId:1182143]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: A1431 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6N8D (0-End)
  • Chain 'E':
    Compound: A1431 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6N8D (0-End)
    Domains in SCOPe 2.07: d6n8de1, d6n8de2
  • Chain 'F':
    Compound: A1431 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6N8D (0-End)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n8dB (B:)
    eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa
    rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8dB (B:)
    eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa
    rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6n8dE (E:)
    eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa
    rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8dE (E:)
    eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa
    rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    No sequence available.