Lineage for d6n8de1 (6n8d E:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3070668Domain d6n8de1: 6n8d E:1-106 [370730]
    Other proteins in same PDB: d6n8db2, d6n8de2
    automated match to d1dn0a1

Details for d6n8de1

PDB Entry: 6n8d (more details), 3.1 Å

PDB Description: crystal structure of gii.4 2002 norovirus p domain in complex with neutralizing human antibody a1431
PDB Compounds: (E:) A1431 Fab light chain

SCOPe Domain Sequences for d6n8de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n8de1 b.1.1.1 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspaslslspgeratlsckasrsisiylawyqqkpgqaprlliydasyraigipa
rfsgsgsgtdftltisnlepedfavyycqhrsswpaltfgggtkvei

SCOPe Domain Coordinates for d6n8de1:

Click to download the PDB-style file with coordinates for d6n8de1.
(The format of our PDB-style files is described here.)

Timeline for d6n8de1:

  • d6n8de1 appears in periodic updates to SCOPe 2.07 starting on 2019-07-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6n8de2