Lineage for d5mlkb2 (5mlk B:340-465)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817716Species Mycobacterium tuberculosis [TaxId:83332] [330750] (1 PDB entry)
  8. 2817718Domain d5mlkb2: 5mlk B:340-465 [330771]
    Other proteins in same PDB: d5mlka1, d5mlka2, d5mlkb1, d5mlkb3
    automated match to d2c00a3

Details for d5mlkb2

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlkb2:

Sequence, based on SEQRES records: (download)

>d5mlkb2 b.84.2.0 (B:340-465) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rghaiefringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlakli
vhgadraealararralnefgveglatvipfhravvsdpafigdangfsvhtrwietewn
ntiepf

Sequence, based on observed residues (ATOM records): (download)

>d5mlkb2 b.84.2.0 (B:340-465) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rghaiefringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlakli
vhgadraealararralnefgveglatvipfhravvsdpafiggfsvhtrwietewnnti
epf

SCOPe Domain Coordinates for d5mlkb2:

Click to download the PDB-style file with coordinates for d5mlkb2.
(The format of our PDB-style files is described here.)

Timeline for d5mlkb2: