SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mlkb1 (5mlk B:10-124)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107110Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2107111Protein automated matches [226903] (34 species)
    not a true protein
  7. 2287445Species Mycobacterium tuberculosis [TaxId:83332] [330746] (1 PDB entry)
  8. 2287469Domain d5mlkb1: 5mlk B:10-124 [330770]
    Other proteins in same PDB: d5mlka2, d5mlka3, d5mlkb2
    automated match to d2vqda1

Details for d5mlkb1

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlkb1 c.30.1.0 (B:10-124) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ariskvlvanrgeiavrviraardaglpsvavyaepdaesphvrladeafalggqtsaes
yldfakildaaaksganaihpgygflaenadfaqavidagliwigpspqsirdlg

SCOPe Domain Coordinates for d5mlkb1:

Click to download the PDB-style file with coordinates for d5mlkb1.
(The format of our PDB-style files is described here.)

Timeline for d5mlkb1:

  • d5mlkb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09