PDB entry 5mlk

View 5mlk on RCSB PDB site
Description: Biotin dependent carboxylase AccA3 dimer from Mycobacterium tuberculosis (Rv3285)
Class: ligase
Keywords: Biotin dependant carboxylase, GRASP, Ligase
Deposited on 2016-12-07, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: accA3, Rv3285, LH57_17955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mlka1, d5mlka2, d5mlka3
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: accA3, Rv3285, LH57_17955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mlkb1, d5mlkb2, d5mlkb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mlkA (A:)
    maswshpqfekgahmashagsriariskvlvanrgeiavrviraardaglpsvavyaepd
    aesphvrladeafalggqtsaesyldfakildaaaksganaihpgygflaenadfaqavi
    dagliwigpspqsirdlgdkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpia
    ikaahggggkgmkvartideipelyesavreataafgrgecyveryldkprhveaqviad
    qhgnvvvagtrdcslqrryqklveeapapfltdfqrkeihdsakrickeahyhgagtvey
    lvgqdglisflevntrlqvehpvteetagidlvlqqfriangeklditedptprghaief
    ringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlaklivhgadra
    ealararralnefgveglatvipfhravvsdpafigdangfsvhtrwietewnntiepft
    dgepldedarprqkvvveidgrrvevslpadlalsngggcdpvgvirrkpkprkrgahtg
    aaasgdavtapmqgtvvkfaveegqevvagdlvvvleamkmenpvtahkdgtitglavea
    gaaitqgtvlaeik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mlkA (A:)
    ariskvlvanrgeiavrviraardaglpsvavyaepdaesphvrladeafalggqtsaes
    yldfakildaaaksganaihpgygflaenadfaqavidagliwigpspqsirdlgdkvta
    rhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahgmkvartideipelyesa
    vreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrryqklveeapa
    pfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlqvehpvteeta
    gidlvlqqfriangeklditedptprghaiefringedagrnflpapgpvtkfhppsgpg
    vrvdsgvetgsviggqfdsmlaklivhgadraealararralnefgveglatvipfhrav
    vsdpafigdangfsvhtrwietewnntiepf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mlkB (B:)
    maswshpqfekgahmashagsriariskvlvanrgeiavrviraardaglpsvavyaepd
    aesphvrladeafalggqtsaesyldfakildaaaksganaihpgygflaenadfaqavi
    dagliwigpspqsirdlgdkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpia
    ikaahggggkgmkvartideipelyesavreataafgrgecyveryldkprhveaqviad
    qhgnvvvagtrdcslqrryqklveeapapfltdfqrkeihdsakrickeahyhgagtvey
    lvgqdglisflevntrlqvehpvteetagidlvlqqfriangeklditedptprghaief
    ringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlaklivhgadra
    ealararralnefgveglatvipfhravvsdpafigdangfsvhtrwietewnntiepft
    dgepldedarprqkvvveidgrrvevslpadlalsngggcdpvgvirrkpkprkrgahtg
    aaasgdavtapmqgtvvkfaveegqevvagdlvvvleamkmenpvtahkdgtitglavea
    gaaitqgtvlaeik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mlkB (B:)
    ariskvlvanrgeiavrviraardaglpsvavyaepdaesphvrladeafalggqtsaes
    yldfakildaaaksganaihpgygflaenadfaqavidagliwigpspqsirdlgdkvta
    rhiaaraqaplvpyldkprhveaqviadqhgnvvvagtrdcslqrryqklveeapapflt
    dfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlqvehpvteetagidl
    vlqqfriangeklditedptprghaiefringedagrnflpapgpvtkfhppsgpgvrvd
    sgvetgsviggqfdsmlaklivhgadraealararralnefgveglatvipfhravvsdp
    afiggfsvhtrwietewnntiepf