SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mlka2 (5mlk A:125-339)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (31 species)
    not a true protein
  7. 2287447Species Mycobacterium tuberculosis [TaxId:83332] [330748] (1 PDB entry)
  8. 2287448Domain d5mlka2: 5mlk A:125-339 [330749]
    Other proteins in same PDB: d5mlka1, d5mlka3, d5mlkb1, d5mlkb2
    automated match to d2vqda2

Details for d5mlka2

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlka2:

Sequence, based on SEQRES records: (download)

>d5mlka2 d.142.1.0 (A:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahggggkgmkvarti
deipelyesavreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrr
yqklveeapapfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlq
vehpvteetagidlvlqqfriangeklditedptp

Sequence, based on observed residues (ATOM records): (download)

>d5mlka2 d.142.1.0 (A:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahgmkvartideipe
lyesavreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrryqklv
eeapapfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlqvehpv
teetagidlvlqqfriangeklditedptp

SCOPe Domain Coordinates for d5mlka2:

Click to download the PDB-style file with coordinates for d5mlka2.
(The format of our PDB-style files is described here.)

Timeline for d5mlka2:

  • d5mlka2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08