Lineage for d5mlka2 (5mlk A:125-339)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (32 species)
    not a true protein
  7. 2287447Species Mycobacterium tuberculosis [TaxId:83332] [330748] (1 PDB entry)
  8. 2287448Domain d5mlka2: 5mlk A:125-339 [330749]
    Other proteins in same PDB: d5mlka1, d5mlka3, d5mlkb1, d5mlkb2
    automated match to d2vqda2

Details for d5mlka2

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlka2:

Sequence, based on SEQRES records: (download)

>d5mlka2 d.142.1.0 (A:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahggggkgmkvarti
deipelyesavreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrr
yqklveeapapfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlq
vehpvteetagidlvlqqfriangeklditedptp

Sequence, based on observed residues (ATOM records): (download)

>d5mlka2 d.142.1.0 (A:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahgmkvartideipe
lyesavreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrryqklv
eeapapfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlqvehpv
teetagidlvlqqfriangeklditedptp

SCOPe Domain Coordinates for d5mlka2:

Click to download the PDB-style file with coordinates for d5mlka2.
(The format of our PDB-style files is described here.)

Timeline for d5mlka2:

  • d5mlka2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08