SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mlka3 (5mlk A:340-465)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072108Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2072233Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2072234Protein automated matches [254496] (12 species)
    not a true protein
  7. 2287449Species Mycobacterium tuberculosis [TaxId:83332] [330750] (1 PDB entry)
  8. 2287450Domain d5mlka3: 5mlk A:340-465 [330751]
    Other proteins in same PDB: d5mlka1, d5mlka2, d5mlkb1
    automated match to d2c00a3

Details for d5mlka3

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlka3 b.84.2.0 (A:340-465) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rghaiefringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlakli
vhgadraealararralnefgveglatvipfhravvsdpafigdangfsvhtrwietewn
ntiepf

SCOPe Domain Coordinates for d5mlka3:

Click to download the PDB-style file with coordinates for d5mlka3.
(The format of our PDB-style files is described here.)

Timeline for d5mlka3:

  • d5mlka3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09