Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Schistosoma japonicum [TaxId:6182] [276183] (5 PDB entries) |
Domain d5gzzf2: 5gzz F:81-216 [329744] Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze1, d5gzzf1, d5gzzg1, d5gzzg2 automated match to d3isoa2 complexed with gsh, jaa |
PDB Entry: 5gzz (more details), 2.39 Å
SCOPe Domain Sequences for d5gzzf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gzzf2 a.45.1.0 (F:81-216) automated matches {Schistosoma japonicum [TaxId: 6182]} mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia wplqgwqatfgggdhp
Timeline for d5gzzf2: