Lineage for d5gzze1 (5gzz E:1-80)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2119987Species Schistosoma japonicum [TaxId:6182] [225614] (7 PDB entries)
  8. 2286480Domain d5gzze1: 5gzz E:1-80 [329781]
    Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze2, d5gzzf2, d5gzzg1, d5gzzg2
    automated match to d3isoa1
    complexed with gsh, jaa

Details for d5gzze1

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (E:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzze1 c.47.1.0 (E:1-80) automated matches {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d5gzze1:

Click to download the PDB-style file with coordinates for d5gzze1.
(The format of our PDB-style files is described here.)

Timeline for d5gzze1:

  • d5gzze1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15