Lineage for d5gzzc2 (5gzz C:81-216)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2321907Protein Class alpha GST [81349] (8 species)
  7. 2322040Species Schistosoma japonicum [TaxId:6182] [47633] (14 PDB entries)
    Uniprot P08515
  8. 2322052Domain d5gzzc2: 5gzz C:81-216 [329736]
    Other proteins in same PDB: d5gzzb1, d5gzzc1, d5gzzd1, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg1
    automated match to d1m9aa1
    complexed with gsh, jaa

Details for d5gzzc2

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (C:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzzc2 a.45.1.1 (C:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d5gzzc2:

Click to download the PDB-style file with coordinates for d5gzzc2.
(The format of our PDB-style files is described here.)

Timeline for d5gzzc2: