SCOPe 2.08: Domain d5gzzd1: 5gzz D:1-80

Lineage for d5gzzd1 (5gzz D:1-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
   Uniprot P08515

8. Domain d5gzzd1: 5gzz D:1-80 [329723]
   Other proteins in same PDB: d5gzzb2, d5gzzc2, d5gzzd2, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg2
   automated match to d1m9aa2
   complexed with gsh, jaa

Details for d5gzzd1

PDB Entry: 5gzz, 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja

PDB Compounds: (D:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzd1:

Sequence; same for both SEQRES and ATOM records:

>d5gzzd1 c.47.1.5 (D:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d5gzzd1:

• d5gzzd1 first appeared in SCOPe 2.06
  
• d5gzzd1 appears in SCOPe 2.07