SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gzze2 (5gzz E:81-216)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 1997717Species Schistosoma japonicum [TaxId:6182] [276183] (3 PDB entries)
  8. 2286481Domain d5gzze2: 5gzz E:81-216 [329782]
    Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze1, d5gzzf1, d5gzzg1, d5gzzg2
    automated match to d3isoa2
    complexed with gsh, jaa

Details for d5gzze2

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (E:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzze2 a.45.1.0 (E:81-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d5gzze2:

Click to download the PDB-style file with coordinates for d5gzze2.
(The format of our PDB-style files is described here.)

Timeline for d5gzze2:

  • d5gzze2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16